PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016467287.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 500aa    MW: 57060.9 Da    PI: 10.6698
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016467287.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding254.5e-081248138
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlk 38
                     +++W t+E+++l  av+++G+++W+ +a+++   Rt +
   XP_016467287.1 12 KMNWGTWEELILGGAVRRHGTRDWNVVASELR-ARTVY 48
                     689*****************************.88865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.6E-5866IPR009057Homeodomain-like
PROSITE profilePS500906.2721165IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.606.7E-51263IPR009057Homeodomain-like
PfamPF002491.7E-61247IPR001005SANT/Myb domain
CDDcd001673.06E-41461No hitNo description
SuperFamilySSF473701.7E-18265371IPR001487Bromodomain
SMARTSM002971.1E-16267371IPR001487Bromodomain
CDDcd043694.16E-15270366No hitNo description
Gene3DG3DSA:1.20.920.104.6E-17270396IPR001487Bromodomain
PfamPF004393.4E-11276355IPR001487Bromodomain
PROSITE profilePS5001410.829282352IPR001487Bromodomain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MEGETMGVGP RKMNWGTWEE LILGGAVRRH GTRDWNVVAS ELRARTVYPY CFTPEACRTR  60
YEDLRKRYSG CNAWFEELRK RRVEELKREL ERSESSIGFL ESKIESLKAE RKQSGQIDYG  120
LGRTESPAPP TKSEDIESFV KDEAKDGLSA GSFTLDIRTN QSPESQVPTI PSTDVKLERS  180
ESCERDKVPS TSKVTEASNG NGGAVRKRRG KRRRKDTVWD AKEGSIEESD NVCSTSLAST  240
SHCKEALTSC EQSIRHSAVS DHRGGLSRFR NDDLMRIFTS ITQHEAAMVF RHRLDSQKRA  300
RYKKMIRRHM DIETVKSRLA SWSIKTPGEL FRDFLLLANN AMVFYSKRTR EYKAAMALRD  360
IVTRAYRQHY RGSYYKATSC LLLLPTIGNP PGKPRSVRPR PSKDKLQAKY GNNVKDNIAG  420
KLGRQNHRPG DADSKVPLQS FLSAKKGFKR PGKIKRGPIL ESVKPQTKLQ AKESTQHNIK  480
VKEDHRIKPV TKERKRARQK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16481RKRYSGCNAWFEELRKRR
2207215RRGKRRRKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009778975.10.0PREDICTED: uncharacterized protein LOC104228236 isoform X1
RefseqXP_016467287.10.0PREDICTED: uncharacterized protein LOC107789922 isoform X1
TrEMBLM1C1L50.0M1C1L5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000577580.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55341924
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42150.13e-23DNA-binding bromodomain-containing protein